PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G06560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 993aa    MW: 109157 Da    PI: 4.8851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G06560.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.1e-085076127
                     TSSS-HHHHHHHHHHHHHTTTT-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktI 27
                     +g+WT+eEd +l +av+ + g++Wk+I
  OPUNC12G06560.1 50 KGNWTPEEDAILSRAVQTYKGKNWKKI 76
                     79************************9 PP

2Myb_DNA-binding59.95.4e-19102148148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  OPUNC12G06560.1 102 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                      79******************************.*************97 PP

3Myb_DNA-binding47.25.1e-15154196145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  OPUNC12G06560.1 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 196
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7374596IPR017877Myb-like domain
SMARTSM007171.74998IPR001005SANT/Myb domain
PfamPF002492.3E-65076IPR001005SANT/Myb domain
SuperFamilySSF466895.1E-850100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-1552113IPR009057Homeodomain-like
PROSITE profilePS5129431.40497152IPR017930Myb domain
SuperFamilySSF466891.55E-3099195IPR009057Homeodomain-like
SMARTSM007172.2E-17101150IPR001005SANT/Myb domain
PfamPF002493.3E-17102148IPR001005SANT/Myb domain
CDDcd001675.11E-15104148No hitNo description
Gene3DG3DSA:1.10.10.606.1E-26114156IPR009057Homeodomain-like
PROSITE profilePS5129419.654153203IPR017930Myb domain
SMARTSM007174.4E-14153201IPR001005SANT/Myb domain
PfamPF002491.9E-13154197IPR001005SANT/Myb domain
CDDcd001677.09E-11156196No hitNo description
Gene3DG3DSA:1.10.10.607.1E-21157203IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
MASDNGKAPE KGGEASGPPS APQEGEISNE PQRRRPLSGR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYKG KNWKKIGCIK NNIYISQYYP RWQKVLNPEL VKGPWSKEED DIIVQMVNKL  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNA IKNHWNSSVK KKVDSYMSSG LLTQVSCLPL NEYSVHCNSS PAVTQQNSED  240
SGSYAVREVE NSSGCSQSSL AKVSCSQVHN ANVALGCDLQ VNANVDKNET HDSQSSVGHE  300
ACYTSVEAVS TAMPEVHYHV SSSNFDLDQH LQEEFAQGLN LHMSIDEVPS NSSFADNPTI  360
CSIENHERSL EPYDVAMEMP LSMLQSDPGA EQKLHFMSEA DFNSPNCLKS ELWQDISLQS  420
LLSGPDAVET DSFSRSNHQS DVYSSQADTE FLAPPYLLQT SNSSSVMEAT YGQSPQMSVP  480
PSLICSNVMT DVPSDNRSEP KEMPVSQAEM VTQSSSSSGD AEMSANPCSS NDSDVPSMME  540
RIPECTDQQV TNAEEPEASI EKEPSVTPVV TATDEKQDEG ALFYEPPRFP SMDVPFVSCD  600
LVTSGDLQEY SPLGIRQLMR STMNVCTPMR LWGSPTHDES PDILLKSAAK SFICTPSILK  660
KRHRDLVSPI PDKRIEKKSG TEKDCGVSDT SSIGIQTCFI NATKDDAVIT KSVLRSASFK  720
PLEKKLEFSD ENKENLDNTT EQAKDGQSAG NDKHIDEQAR GEQRTATNIT ITYDDLPCNL  780
QPAGILIEHN GDDLVSPDHG KNTMKQKQNT NMESLSVCKE GVSGKLKPTE LIVEKSSACI  840
NVDYEYVNIL ADTPGIKRGL ESPSAWKSPW FVDMQFQGSY FVSPADRTYD ALGLVKQINV  900
QTAAALAEAR EVLASGGQSE NINSDKENLE NPDAKKEPGA TTKLQAKIKT EGKILDFNEC  960
ATPIRSSDRK AGSSLGRSLS SPIPSSHLLK SFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-57502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-57502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663924.20.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLA0A0E0MKY80.0A0A0E0MKY8_ORYPU; Uncharacterized protein
STRINGLOC_Os12g13570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-82Homeodomain-like protein